Escherichia coli 562 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information taxon This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information aMAZESpecificCompound0000000638 aMAZE This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information R01786 KEGG SMILES C1(C(O)C(O)C(O)C(O1)CO)(O) This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information C05345 KEGG 1.0 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information <FONT FACE="Symbol">a</FONT>-D-glucose C00267 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information KEGG a-D-glu KEGG This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information aMAZE aMAZESpecificCompound0000000263 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information see http://www.amaze.ulb.ac.be/ aMAZE This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information C6H12O6 180.16 alpha-D-glucose This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information Gene Ontology GO:0005737 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information cytoplasm P46880 Swiss-Prot/TrEMBL This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information Adenosine 5'-diphosphate adenosine diphosphate This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information aMAZE aMAZESpecificCompound0000000008 427.2 ADP This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information c12(n(cnc(c(N)ncn1)2)[CH]3(O[CH]([CH](O)[CH](O)3)COP(=O)(O)OP(O)(=O)O)) SMILES C10H15N5O10P2 KEGG This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information C00008 see http://www.amaze.ulb.ac.be/ This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information aMAZESpecificCompound0000004507 aMAZE 1.0 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information a-D-glu-6-p C6H13O9P <FONT FACE="Symbol">a</FONT>-D-glucose-6-phoshate C00668 KEGG This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information 260.14 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information see http://www.amaze.ulb.ac.be/ glucose-6-P alpha-D-glucose-6-p SMILES C(OP(=O)(O)O)[CH]1([CH](O)[CH](O)[CH](O)[CH](O)O1) This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information alpha-D-glucose 6-phosphate alpha-D-glucose-6-phosphate D-glucose-6-P 0.4 alpha-D-Glucose 6-phosphate <=> beta-D-Fructose 6-phosphate This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information C6H13O9P <FONT FACE="Symbol">b</FONT>-D-fructose-6-phosphate b-D-fru-6-p C(OP(O)(O)=O)[CH]1([CH](O)[CH](O)C(O)(O1)CO) This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information SMILES 260.14 beta-D-fructose 6-phosphate beta-D-fructose-6-phosphate This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information see http://www.amaze.ulb.ac.be/ 1.0 a-D-glu-6-p <=> b-D-fru-6-p Note: If filled, the value of the PARTICIPANTS slot should be the union of the LEFT and RIGHT slots. see http://www.amaze.ulb.ac.be/ 5.3.1.9 R02740 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information KEGG alpha-D-glu-6-p <=> beta-D-fru-6-p alpha-D-Glucose 6-phosphate ketol-isomerase aMAZE aMAZEReaction0000002504 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information 1.0 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information see http://www.amaze.ulb.ac.be/ This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information aMAZESpecificCompound0000000002 aMAZE This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information [CH]3(n1(c2(c(nc1)c(N)ncn2)))(O[CH]([CH](O)[CH](O)3)COP(=O)(O)OP(O)(=O)OP(O)(=O)O) SMILES 507.18 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information C10H16N5O13P3 adenosine triphosphate This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information KEGG C00002 ATP Adenosine 5'-triphosphate This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information aMAZEReaction0000001619 aMAZE The source of this data did not store catalyses of reactions as separate objects, so there are no unification x-refs pointing to the source of these BioPAX instances. This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information PHYSIOL-LEFT-TO-RIGHT see http://www.amaze.ulb.ac.be/ GLK Swiss-Prot/TrEMBL This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQTLGHIL see http://www.amaze.ulb.ac.be/ Glucose kinase This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information GLK_ECOLI glucokinase 1.0 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information Note: The PARTICIPANTS slot may be left empty if both the CONTROLLED and CONTROLLER slots are filled. GLK -> (a-D-glu <=> a-D-glu-6-p) catalysis of (alpha-D-glu <=> alpha-D-glu-6-p) This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information ATP:D-glucose 6-phosphotransferase alpha-D-glu + ATP <=> alpha-D-glu-6-p + ADP 2.7.1.2 1.0 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information see http://www.amaze.ulb.ac.be/ Note: The PARTICIPANTS slot may be left empty if both the LEFT and RIGHT slots are filled. glucose ATP phosphotransferase a-D-glu <=> a-D-glu-6-p 2.7.1.1 aMAZEProcess0000000027 aMAZE This is the source of this data. This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information The source of this data did not store catalyses of reactions as separate objects, so there are no unification x-refs pointing to the source of these BioPAX instances. PHYSIOL-LEFT-TO-RIGHT This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information 1.0 PHI Q9KH85 Swiss-Prot/TrEMBL This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information PGI GPI see http://www.amaze.ulb.ac.be/ aMAZEPolypeptide0000050740 aMAZE This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information Phosphohexose isomerase phosphoglucose isomerase KTFSEAIISGEWKGYTGKAITDVVNIGIGGSDLGPYMVTEALRPYKNHLNMHFVSNVDGTHIAEVLKKVNPETTLFLVASKTFTTQETMTNAHSARDWFLKAAGDEKHVAKHFAALSTNAKAVGEFGIDTANMFEFWDWVGGRYSLWSAIGLSIVLSIGFDNFVELLSGAHAMDKHFSTTPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQYMHRFAAYFQQGNMESNGKYVDRNGNVVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKMVPCDFIAPAITHNPLFDHHQKLLSKFFAQTEALAFGKSREVVEQEYRDQGKDPAT This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information Glucose-6-phosphate isomerase This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information PGI -> (a-D-glu-6-p <=> b-D-fru-6-p) catalysis of (alpha-D-glu-6-p <=> beta-D-fru-6-p) Note: If filled, the value of the PARTICIPANTS slot should be the union of the CONTROLLED and CONTROLLER slots. see http://www.amaze.ulb.ac.be/ This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information glucose degradation This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information PubMed 2549346 This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information This example is meant to provide an illustration of how various BioPAX slots should be filled; it is not intended to provide useful (or even accurate) biological information Embden-Meyerhof pathway Glycolysis Pathway glycolysis see http://www.amaze.ulb.ac.be/